"ATP5F1" Related Products

Expand
Expand

Recombinant Human ATP5F1, His-tagged

Cat.No.: ATP5F1-37H
Product Overview: Recombinant Human ATP Synthase Subunit B Mitochondrial/ATP5F1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro43-Met256) of Human ATP5F1 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLG VMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRN NIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIA KCIADLKLLAKKAQAQPVMVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 [ Homo sapiens ]
Official Symbol: ATP5F1
Synonyms: ATP5F1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase subunit b, mitochondrial; ATPase subunit b; H+-ATP synthase subunit b; ATP synthase B chain, mitochondrial; cell proliferation-inducing protein 47; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; PIG47; MGC24431;
Gene ID: 515
mRNA Refseq: NM_001688
Protein Refseq: NP_001679
MIM: 603270
UniProt ID: P24539
Chromosome Location: 1p13.2
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: contributes_to ATPase activity; hydrogen ion transmembrane transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein binding; transmembrane transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.