"PPBP" Related Products

Expand
Expand
Expand

Recombinant Human PPBP, GST-tagged

Cat.No.: PPBP-206H
Product Overview: Recombinant Human PPBP(1 a.a. - 128 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 40.3 kDa
AA Sequence: MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPK NIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens (human) ]
Official Symbol: PPBP
Synonyms: PPBP; PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); platelet basic protein; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7
Gene ID: 5473
mRNA Refseq: NM_002704
Protein Refseq: NP_002695
MIM: 121010
UniProt ID: P02775
Chromosome Location: 4q12-q13
Pathway: Chemokine receptors bind chemokines; Chemokine signaling pathway; Cytokine-cytokine receptor interaction
Function: chemokine activity; glucose transmembrane transporter activity; growth factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.