"DVL2" Related Products

Expand
Expand

Recombinant Human DVL2, GST-tagged

Cat.No.: DVL2-107H
Product Overview: Recombinant Human DVL2(1 a.a. - 736 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 105.3 kDa
AA Sequence: MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDN ARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPE TETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTE QSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPID PAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIP NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDND GSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMAL PYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DVL2 dishevelled, dsh homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol: DVL2
Synonyms: DVL2; dishevelled, dsh homolog 2 (Drosophila); dishevelled 2 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-2; dishevelled 2 (homologous to Drosophila dsh); Dishevelled dsh homolog 2; Dishevelled-2; Dishevelled2; DSH homolog 2; DVL 2; Dvl2; DVL2_HUMAN; Segment polarity protein dishevelled homolog DVL 2; Segment polarity protein dishevelled homolog DVL-2; Segment polarity protein dishevelled homolog DVL2; DSH homolog 2; dishevelled-2; OTTHUMP00000128349
Gene ID: 1856
mRNA Refseq: NM_004422
Protein Refseq: NP_004413
MIM: 602151
UniProt ID: O14641
Chromosome Location: 17p13.1
Pathway: Basal cell carcinoma; Canonical Wnt signaling pathway; DNA damage response (only ATM dependent)
Function: frizzled binding; identical protein binding; protein binding; protein domain specific binding; protein self-association

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.