"LDHC" Related Products

Expand

Recombinant Human LDHC, GST-tagged

Cat.No.: LDHC-259H
Product Overview: Recombinant Human LDHC(71 a.a. - 160 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 35.64 kDa
AA Sequence: FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTY IVWKISGLPVTRVIG
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: LDHC lactate dehydrogenase C [ Homo sapiens (human) ]
Official Symbol: LDHC
Synonyms: LDHC; lactate dehydrogenase C; CT32; LDH3; LDHX; L-lactate dehydrogenase C chain; LDH testis subunit; LDH-C; LDH-X; cancer/testis antigen 32; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; NP_002292.1; EC 1.1.1.27; NP_059144.1
Gene ID: 3948
mRNA Refseq: NM_002301
Protein Refseq: NP_002292
MIM: 150150
UniProt ID: P07864
Chromosome Location: 11p15.1
Pathway: Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis; Propanoate metabolism
Function: L-lactate dehydrogenase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.