Recombinant Human LDHD, GST-tagged LDHD-260H

Recombinant Human LDHD, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LDHD, GST-tagged

Recombinant Human LDHD, GST-tagged

LDHD Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LDHD-260H
Product Overview : Recombinant Human LDHD(1 a.a. - 507 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 81.3 kDa
AA Sequence : MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNV EQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTRKALNAHLRDS GLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYS PCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWY AALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQ LGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : LDHD lactate dehydrogenase D [ Homo sapiens (human) ]
Official Symbol : LDHD
Synonyms : LDHD; lactate dehydrogenase D; probable D-lactate dehydrogenase, mitochondrial; D-lactate dehydrogenase; DLD; MGC57726; NP_705690.2; EC 1.1.2.4; NP_919417.1
Gene ID : 197257
mRNA Refseq : NM_153486
Protein Refseq : NP_705690
MIM : 607490
UniProt ID : Q86WU2
Chromosome Location : 16q23.1
Pathway : Metabolism of proteins; Mitochondrial protein import; Pyruvate metabolism; methylglyoxal degradation I
Function : D-lactate dehydrogenase (cytochrome) activity; UDP-N-acetylmuramate dehydrogenase activity; flavin adenine dinucleotide binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy