"LDHD" Related Products

Expand
Expand

Recombinant Human LDHD, GST-tagged

Cat.No.: LDHD-260H
Product Overview: Recombinant Human LDHD(1 a.a. - 507 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 81.3 kDa
AA Sequence: MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNV EQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTRKALNAHLRDS GLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYS PCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWY AALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQ LGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: LDHD lactate dehydrogenase D [ Homo sapiens (human) ]
Official Symbol: LDHD
Synonyms: LDHD; lactate dehydrogenase D; probable D-lactate dehydrogenase, mitochondrial; D-lactate dehydrogenase; DLD; MGC57726; NP_705690.2; EC 1.1.2.4; NP_919417.1
Gene ID: 197257
mRNA Refseq: NM_153486
Protein Refseq: NP_705690
MIM: 607490
UniProt ID: Q86WU2
Chromosome Location: 16q23.1
Pathway: Metabolism of proteins; Mitochondrial protein import; Pyruvate metabolism; methylglyoxal degradation I
Function: D-lactate dehydrogenase (cytochrome) activity; UDP-N-acetylmuramate dehydrogenase activity; flavin adenine dinucleotide binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.