Recombinant Human LDHD, GST-tagged
Cat.No. : | LDHD-260H |
Product Overview : | Recombinant Human LDHD(1 a.a. - 507 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
Molecular Mass : | 81.3 kDa |
AA Sequence : | MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNV EQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTRKALNAHLRDS GLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYS PCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWY AALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQ LGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LDHD lactate dehydrogenase D [ Homo sapiens (human) ] |
Official Symbol | LDHD |
Synonyms | LDHD; lactate dehydrogenase D; probable D-lactate dehydrogenase, mitochondrial; D-lactate dehydrogenase; DLD; MGC57726; NP_705690.2; EC 1.1.2.4; NP_919417.1 |
Gene ID | 197257 |
mRNA Refseq | NM_153486 |
Protein Refseq | NP_705690 |
MIM | 607490 |
UniProt ID | Q86WU2 |
Chromosome Location | 16q23.1 |
Pathway | Metabolism of proteins; Mitochondrial protein import; Pyruvate metabolism; methylglyoxal degradation I |
Function | D-lactate dehydrogenase (cytochrome) activity; UDP-N-acetylmuramate dehydrogenase activity; flavin adenine dinucleotide binding |
◆ Recombinant Proteins | ||
LDHD-9024M | Recombinant Mouse LDHD Protein | +Inquiry |
LDHD-260H | Recombinant Human LDHD, GST-tagged | +Inquiry |
LDHD-5023M | Recombinant Mouse LDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHD-1138H | Recombinant Human LDHD protein, His & GST-tagged | +Inquiry |
LDHD-536H | Recombinant Human LDHD Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHD-979HCL | Recombinant Human LDHD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHD Products
Required fields are marked with *
My Review for All LDHD Products
Required fields are marked with *