Recombinant Human LDHD Protein, His-tagged
Cat.No. : | LDHD-536H |
Product Overview : | Recombinant Human LDHD Protein(159-507 aa), fused with His tag, was expressed in E. coli. |
Availability | August 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 159-507 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LDHD lactate dehydrogenase D [ Homo sapiens (human) ] |
Official Symbol | LDHD |
Synonyms | LDHD; lactate dehydrogenase D; DLD; probable D-lactate dehydrogenase, mitochondrial; D-lactate dehydrogenase |
Gene ID | 197257 |
mRNA Refseq | NM_153486 |
Protein Refseq | NP_705690 |
UniProt ID | Q86WU2 |
◆ Recombinant Proteins | ||
LDHD-260H | Recombinant Human LDHD, GST-tagged | +Inquiry |
LDHD-536H | Recombinant Human LDHD Protein, His-tagged | +Inquiry |
LDHD-6971HF | Recombinant Full Length Human LDHD Protein, GST-tagged | +Inquiry |
LDHD-10246Z | Recombinant Zebrafish LDHD | +Inquiry |
LDHD-1138H | Recombinant Human LDHD protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHD-979HCL | Recombinant Human LDHD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHD Products
Required fields are marked with *
My Review for All LDHD Products
Required fields are marked with *