Recombinant Human Interleukin 33 IL33-58H

Recombinant Human Interleukin 33

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Interleukin 33

Recombinant Human Interleukin 33

IL33 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : IL33-58H
Product Overview : Recombinant Human Interleukin33 produced inE.Coliis a single, non-glycosylated, polypeptide chain containing 160 amino acids and having a molecular mass of 18 kDa. The IL-33 is purified by proprietary chromatographic techniques.
Description : Interleukin 33 (IL-33) is a 32kDa proinflammatory cytokine that may also regulate gene transcription in producer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1 (IL1 receptor-like-1), which is known also as ST2. Binding of IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces expression of IL-4, IL-5, IL-13 and leads to severe pathological changes in mucosal organs and in vitro, it can be divided to N-terminal fragment of 12kDa and C-terminal fragment of 18kDa by cleavage of caspase-1.
Source : Escherichia Coli.
Amino Acid Sequence : MSITGISPITEYL ASLSTYNDQSIT FALEDESYEIYV EDLKKDEKKD KVLLSYYESQH PSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNM HSNCVSF EC KTDPGVFIGVKDNHLALI KVDSSENLCT ENILFKLSET.
Physical Appearance : Sterile Filtered colorless liquid at a concentration of 1 mg/ml.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : The protein is formulated in 20mM Tris pH-8.
Biological Activity : The ED50 as determined by the dose-dependant stimulation of TF-1 cells is < 0.1 ng/ml, corresponding to a Specific Activity of 1 x 107IU/mg.
Storage : IL-33 although stable at 14°Cfor 1 week, should be stored desiccated below -18°C. Upon arrival IL33 Recombinant should be stored at 4°Cbetween 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name : IL33 interleukin 33 [ Homo sapiens ]
Synonyms : IL33; interleukin 33; DVS27; NF-HEV; NFEHEV; C9orf26; DKFZp586H0523; RP11-575C20.2; DVS27-related protein; nuclear factor from high endothelial venules; chromosome 9 open reading frame 26 (NF-HEV); IL-1F11; IL-33; IL1F11; NFHEV; OTTHUMP00000021041; Interleukin-1 family member 11; Nuclear factor from high endothelial venules
Gene ID : 90865
mRNA Refseq : NM_033439
Protein Refseq : NP_254274
MIM : 608678
UniProt ID : O95760
Chromosome Location : 9p24.1
Function : cytokine activity; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy