Recombinant Human AMBN

PRODUCTS

Home / Products / Antibody / Recombinant Human AMBN

Recombinant Human AMBN

AMBN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : AMBN-27234TH
Product Overview : Recombinant full length Human AMBN with N terminal proprrietary tag; Predicted MW 75.24kDa.
Description : This gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. This gene is located in the calcium-binding phosphoprotein gene cluster on chromosome 4. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect.
Protein length : 447 amino acids
Molecular Weight : 75.240kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMA SLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLL PPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQ PGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGEL PLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPG MLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEE GGAQGSPMPEANPDNLENPAFLTELEPAPHAGLLALPKDD IPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHD AWHFQEP
Sequence Similarities : Belongs to the ameloblastin family.
Gene Name : AMBN ameloblastin (enamel matrix protein) [ Homo sapiens ]
Official Symbol : AMBN
Synonyms : AMBN; ameloblastin (enamel matrix protein); ameloblastin, enamel matrix protein; ameloblastin;
Gene ID : 258
mRNA Refseq : NM_016519
Protein Refseq : NP_057603
MIM : 601259
Uniprot ID : Q9NP70
Chromosome Location : 4q21
Function : growth factor activity; structural constituent of tooth enamel;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.