"AMBN" Related Products

Expand

Recombinant Human AMBN

Cat.No.: AMBN-27234TH
Product Overview: Recombinant full length Human AMBN with N terminal proprrietary tag; Predicted MW 75.24kDa.
Description: This gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. This gene is located in the calcium-binding phosphoprotein gene cluster on chromosome 4. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect.
Protein length: 447 amino acids
Molecular Weight: 75.240kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMA SLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLL PPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQ PGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGEL PLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPG MLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEE GGAQGSPMPEANPDNLENPAFLTELEPAPHAGLLALPKDD IPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHD AWHFQEP
Sequence Similarities: Belongs to the ameloblastin family.
Gene Name: AMBN ameloblastin (enamel matrix protein) [ Homo sapiens ]
Official Symbol: AMBN
Synonyms: AMBN; ameloblastin (enamel matrix protein); ameloblastin, enamel matrix protein; ameloblastin;
Gene ID: 258
mRNA Refseq: NM_016519
Protein Refseq: NP_057603
MIM: 601259
Uniprot ID: Q9NP70
Chromosome Location: 4q21
Function: growth factor activity; structural constituent of tooth enamel;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.