Recombinant Human CBR1
Cat.No. : | CBR1-26327TH |
Product Overview : | Recombinant full length Human CBR1 , 30kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 277 amino acids |
Description : | Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q. |
Molecular Weight : | 30.000kDa |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.50Constituents:0.32% Tris HCl, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDV TRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKE YGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRS ETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIG VTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | CBR1 carbonyl reductase 1 [ Homo sapiens ] |
Official Symbol | CBR1 |
Synonyms | CBR1; carbonyl reductase 1; CBR; carbonyl reductase [NADPH] 1; SDR21C1; short chain dehydrogenase/reductase family 21C; member 1; |
Gene ID | 873 |
mRNA Refseq | NM_001757 |
Protein Refseq | NP_001748 |
MIM | 114830 |
Uniprot ID | P16152 |
Chromosome Location | 21q22.1 |
Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; |
Function | 15-hydroxyprostaglandin dehydrogenase (NADP+) activity; carbonyl reductase (NADPH) activity; nucleotide binding; oxidoreductase activity; prostaglandin-E2 9-reductase activity; |
◆ Recombinant Proteins | ||
CBR1-591H | Recombinant Human CBR1 Protein, His-tagged | +Inquiry |
RFL3468NF | Recombinant Full Length Neosartorya Fumigata Nadh-Cytochrome B5 Reductase 1(Cbr1) Protein, His-Tagged | +Inquiry |
CBR1-26327TH | Recombinant Human CBR1 | +Inquiry |
RFL31590LF | Recombinant Full Length Lodderomyces Elongisporus Nadh-Cytochrome B5 Reductase 1(Cbr1) Protein, His-Tagged | +Inquiry |
CBR1-9756Z | Recombinant Zebrafish CBR1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBR1-288HCL | Recombinant Human CBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBR1 Products
Required fields are marked with *
My Review for All CBR1 Products
Required fields are marked with *