Recombinant Human CBR1
Cat.No. : | CBR1-26327TH |
Product Overview : | Recombinant full length Human CBR1 , 30kDa. |
- Specification
- Gene Information
- Related Products
Description : | Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q. |
Protein length : | 277 amino acids |
Molecular Weight : | 30.000kDa |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.50Constituents:0.32% Tris HCl, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDV TRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKE YGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRS ETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIG VTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name : | CBR1 carbonyl reductase 1 [ Homo sapiens ] |
Official Symbol : | CBR1 |
Synonyms : | CBR1; carbonyl reductase 1; CBR; carbonyl reductase [NADPH] 1; SDR21C1; short chain dehydrogenase/reductase family 21C; member 1; |
Gene ID : | 873 |
mRNA Refseq : | NM_001757 |
Protein Refseq : | NP_001748 |
MIM : | 114830 |
Uniprot ID : | P16152 |
Chromosome Location : | 21q22.1 |
Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; |
Function : | 15-hydroxyprostaglandin dehydrogenase (NADP+) activity; carbonyl reductase (NADPH) activity; nucleotide binding; oxidoreductase activity; prostaglandin-E2 9-reductase activity; |
Products Types
◆ Recombinant Protein | ||
CBR1-817R | Recombinant Rat CBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBR1-1351H | Recombinant Human CBR1 Protein (2-277 aa), His-tagged | +Inquiry |
Cbr1-791M | Recombinant Mouse Cbr1 Protein, MYC/DDK-tagged | +Inquiry |
CBR1-0467H | Recombinant Human CBR1 Protein, GST-Tagged | +Inquiry |
CBR1-591H | Recombinant Human CBR1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CBR1-288HCL | Recombinant Human CBR1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionGene knockout or knockdown techniques can be used to study the function and mechanism of action of CBR1 proteins. By knocking out or knocking down CBR genes, changes in processes such as cholesterol metabolism and fatty acid synthesis can be observed to further understand their functions and mechanisms of action.
Immunohistochemistry and other methods can be used to analyze the effect of phosphorylation modification of CBR1 protein on its function. Studies have shown that phosphorylation modification can affect the activity and expression level of CBR1 protein, which in turn affects processes such as cholesterol metabolism and fatty acid synthesis.
Yeast two-hybridization, co-immunoprecipitation and other methods can be used to study the interaction of CBR1 protein with other proteins. These methods can determine the types and sites of interacting proteins, and further reveal the regulatory mechanism of CBR1 protein in cells.
The metabolic pathway of CBR1 protein can be analyzed using isotope labeling techniques. The labeled isotope is introduced into the cell or tissue.
It can provide a reference for clinical practice and guide the diagnosis, treatment and prevention of CBR1 protein by detecting the expression level of CBR1 protein and understanding its mechanism of action.
The expression level of CBR1 protein can be regulated through drug interventions, such as the use of cholesterol synthesis inhibitors, fatty acid synthesis inhibitors, etc. These drugs can inhibit the activity or expression level of CBR1 protein, thus achieving the purpose of treating diseases.
Ask a Question for All CBR1 Products
Required fields are marked with *
My Review for All CBR1 Products
Required fields are marked with *
Inquiry Basket