| Description : |
The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Protein length : |
321 amino acids |
| Molecular Weight : |
61.050kDa inclusive of tags |
| Source : |
Wheat germ |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVT FTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEK ISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM ITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAW FLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWK FAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDF A |
| Sequence Similarities : |
Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-7/CHRNA7 sub-subfamily. |
