Recombinant Human CKB, His-tagged

Cat.No. : CKB-26520TH
Product Overview : Recombinant full length Human Creatine Kinase BB with N-terminal His tag; 401 amino acids, MWt 44.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 381 amino acids
Description : The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.
Conjugation : HIS
Molecular Weight : 44.800kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Sequence Similarities : Belongs to the ATP:guanido phosphotransferase family.Contains 1 phosphagen kinase C-terminal domain.Contains 1 phosphagen kinase N-terminal domain.
Gene Name CKB creatine kinase, brain [ Homo sapiens ]
Official Symbol CKB
Synonyms CKB; creatine kinase, brain; CKBB; creatine kinase B-type;
Gene ID 1152
mRNA Refseq NM_001823
Protein Refseq NP_001814
MIM 123280
Uniprot ID P12277
Chromosome Location 14q32.3
Pathway Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem;
Function ATP binding; creatine kinase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKB Products

Required fields are marked with *

My Review for All CKB Products

Required fields are marked with *

0
cart-icon