Recombinant Human CKB, His-tagged
Cat.No. : | CKB-26520TH |
Product Overview : | Recombinant full length Human Creatine Kinase BB with N-terminal His tag; 401 amino acids, MWt 44.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 381 amino acids |
Description : | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. |
Conjugation : | HIS |
Molecular Weight : | 44.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
Sequence Similarities : | Belongs to the ATP:guanido phosphotransferase family.Contains 1 phosphagen kinase C-terminal domain.Contains 1 phosphagen kinase N-terminal domain. |
Gene Name | CKB creatine kinase, brain [ Homo sapiens ] |
Official Symbol | CKB |
Synonyms | CKB; creatine kinase, brain; CKBB; creatine kinase B-type; |
Gene ID | 1152 |
mRNA Refseq | NM_001823 |
Protein Refseq | NP_001814 |
MIM | 123280 |
Uniprot ID | P12277 |
Chromosome Location | 14q32.3 |
Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem; |
Function | ATP binding; creatine kinase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
CKB-1861HF | Recombinant Full Length Human CKB Protein, GST-tagged | +Inquiry |
CKB-1707M | Recombinant Mouse CKB Protein, His (Fc)-Avi-tagged | +Inquiry |
CKB-2127D | Recombinant Dog CKB protein, His-tagged | +Inquiry |
CKB-1418R | Recombinant Rat CKB Protein | +Inquiry |
CKB-344H | Recombinant Human CKB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CKB-8079H | Active Native Human CKB protein | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKB-001HCL | Recombinant Human CKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKB Products
Required fields are marked with *
My Review for All CKB Products
Required fields are marked with *