Recombinant Full Length Human CKB Protein, GST-tagged
| Cat.No. : | CKB-1861HF |
| Product Overview : | Human CKB full-length ORF ( AAH01190, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 381 amino acids |
| Description : | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 67.65 kDa |
| AA Sequence : | MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CKB creatine kinase, brain [ Homo sapiens ] |
| Official Symbol | CKB |
| Synonyms | CKB; creatine kinase, brain; CKBB; creatine kinase B-type; creatine kinase-B; creatine kinase B chain; B-CK |
| Gene ID | 1152 |
| mRNA Refseq | NM_001823 |
| Protein Refseq | NP_001814 |
| MIM | 123280 |
| UniProt ID | P12277 |
| ◆ Recombinant Proteins | ||
| CKB-884R | Recombinant Rhesus monkey CKB Protein, His-tagged | +Inquiry |
| CKB-2729H | Recombinant Human Creatine Kinase, Brain, His-tagged | +Inquiry |
| Ckb-895M | Recombinant Mouse Ckb Protein, MYC/DDK-tagged | +Inquiry |
| CKB-1076R | Recombinant Rat CKB Protein, His (Fc)-Avi-tagged | +Inquiry |
| CKB-495H | Recombinant Human CKB protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
| CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
| CKB-8079H | Active Native Human CKB protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CKB-001HCL | Recombinant Human CKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKB Products
Required fields are marked with *
My Review for All CKB Products
Required fields are marked with *
