"CTSZ" Related Products

Expand
Expand

Recombinant Human CTSZ

Cat.No.: CTSZ-27236TH
Product Overview: Recombinant full length Human Cathepsin Z with a N terminal proprietary tag. Predicted MW 59.40kDa
Description: The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis.
Protein length: 303 amino acids
Molecular Weight: 59.400kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGD GLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASIT RNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAK DQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGRE KMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV
Sequence Similarities: Belongs to the peptidase C1 family.
Gene Name: CTSZ cathepsin Z [ Homo sapiens ]
Official Symbol: CTSZ
Synonyms: CTSZ; cathepsin Z; CTSX;
Gene ID: 1522
mRNA Refseq: NM_001336
Protein Refseq: NP_001327
MIM: 603169
Uniprot ID: Q9UBR2
Chromosome Location: 20q13.32
Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Lysosome Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function: cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.