Recombinant Rat Ctsz protein, His-SUMO-tagged
| Cat.No. : | Ctsz-767R |
| Product Overview : | Recombinant Rat Ctsz protein(Q9R1T3)(64-306aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 64-306aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAIINHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACTFGDPIV |
| Gene Name | Ctsz cathepsin Z [ Rattus norvegicus ] |
| Official Symbol | Ctsz |
| Synonyms | CTSZ; cathepsin Z; cathepsin X; cathepsin Y; CATX; |
| Gene ID | 252929 |
| mRNA Refseq | NM_183330 |
| Protein Refseq | NP_899159 |
| ◆ Recombinant Proteins | ||
| Ctsz-32M | Recombinant Mouse Ctsz Protein, His-tagged | +Inquiry |
| CTSZ-8185H | Recombinant Human CTSZ protein, His & T7-tagged | +Inquiry |
| Ctsz-8186M | Recombinant Mouse Ctsz protein, His-tagged | +Inquiry |
| CTSZ-2328H | Recombinant Human CTSZ, His-tagged | +Inquiry |
| CTSZ-2367HF | Recombinant Full Length Human CTSZ Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSZ-3020MCL | Recombinant Mouse CTSZ cell lysate | +Inquiry |
| CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsz Products
Required fields are marked with *
My Review for All Ctsz Products
Required fields are marked with *
