"DDT" Related Products

Expand
Expand
Expand

Recombinant Human DDT, His-tagged

Cat.No.: DDT-26544TH
Product Overview: Recombinant full length Human DDT with an N terminal His tag; 138aa, 14.8kDa.
Description: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
Protein length: 118 amino acids
Conjugation: HIS
Molecular Weight: 14.800kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Sequence Similarities: Belongs to the MIF family.
Gene Name: DDT D-dopachrome tautomerase [ Homo sapiens ]
Official Symbol: DDT
Synonyms: DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT;
Gene ID: 1652
mRNA Refseq: NM_001084392
Protein Refseq: NP_001077861
MIM: 602750
Uniprot ID: P30046
Chromosome Location: 22q11.23
Pathway: Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem;
Function: D-dopachrome decarboxylase activity; dopachrome isomerase activity; lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.