Recombinant Mouse DDT Protein (1-118aa), N-His tagged

Cat.No. : Ddt-01M
Product Overview : Recombinant mouse Ddt (1-118aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-118aa
Description : Enables protease binding activity. Involved in positive regulation of inflammatory response. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; eye; genitourinary system; and respiratory system. Orthologous to several human genes including DDT (D-dopachrome tautomerase).
Form : Liquid
Molecular Mass : 15.5 kDa (141aa) confirmed by MALDI-TOF
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Gene Name Ddt D-dopachrome tautomerase [ Mus musculus ]
Official Symbol Ddt
Synonyms DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; C78655;
Gene ID 13202
mRNA Refseq NM_010027
Protein Refseq NP_034157
UniProt ID O35215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ddt Products

Required fields are marked with *

My Review for All Ddt Products

Required fields are marked with *

0
cart-icon
0
compare icon