Recombinant Mouse DDT Protein (1-118aa), N-His tagged

• Cat.No.: Ddt-01M
• Product Overview: Recombinant mouse Ddt (1-118aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-118aa
• Description: Enables protease binding activity. Involved in positive regulation of inflammatory response. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; eye; genitourinary system; and respiratory system. Orthologous to several human genes including DDT (D-dopachrome tautomerase).
• Form: Liquid
• Molecular Mass: 15.5 kDa (141aa) confirmed by MALDI-TOF
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol

Gene Information

• Gene Name: Ddt D-dopachrome tautomerase [ Mus musculus ]
• Official Symbol: Ddt
• Synonyms: DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; C78655
• Gene ID: 13202
• mRNA Refseq: NM_010027
• Protein Refseq: NP_034157
• UniProt ID: O35215