Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at BIO-Europe Spring|March 18–20, 2024|Booth #34

Recombinant Human DNAJC3

Cat.No. : DNAJC3-26638TH
Product Overview : Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).
Protein length : 234 amino acids
Molecular Weight : 51.850kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Sequence Similarities : Contains 1 J domain.Contains 9 TPR repeats.
Gene Name : DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
Official Symbol : DNAJC3
Synonyms : DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK;
Gene ID : 5611
mRNA Refseq : NM_006260
Protein Refseq : NP_006251
MIM : 601184
Uniprot ID : Q13217
Chromosome Location : 13q32
Pathway : Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Influenza Infection, organism-specific biosystem;
Function : binding; chaperone binding; heat shock protein binding; misfolded protein binding; protein kinase inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DNAJC3 Products

Required fields are marked with *

My Review for All DNAJC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends