"DNAJC3" Related Products

Expand
Expand

Recombinant Human DNAJC3

Cat.No.: DNAJC3-26638TH
Product Overview: Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa.
Description: This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).
Protein length: 234 amino acids
Molecular Weight: 51.850kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Sequence Similarities: Contains 1 J domain.Contains 9 TPR repeats.
Gene Name: DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
Official Symbol: DNAJC3
Synonyms: DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK;
Gene ID: 5611
mRNA Refseq: NM_006260
Protein Refseq: NP_006251
MIM: 601184
Uniprot ID: Q13217
Chromosome Location: 13q32
Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Influenza Infection, organism-specific biosystem;
Function: binding; chaperone binding; heat shock protein binding; misfolded protein binding; protein kinase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.