Recombinant Human DNAJC3 Protein, GST-tagged
Cat.No. : | DNAJC3-2760H |
Product Overview : | Human DNAJC3 full-length ORF ( AAH33823, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). [provided by RefSeq, Jul 2010] |
Molecular Mass : | 51.48 kDa |
AA Sequence : | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ] |
Official Symbol | DNAJC3 |
Synonyms | DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK; protein kinase inhibitor p58; protein kinase inhibitor of 58 kDa; interferon-induced, double-stranded RNA-activated protein kinase inhibitor; protein-kinase, interferon-inducible double stranded RNA dependent inhibitor; FLJ21288; |
Gene ID | 5611 |
mRNA Refseq | NM_006260 |
Protein Refseq | NP_006251 |
MIM | 601184 |
UniProt ID | Q13217 |
◆ Recombinant Proteins | ||
Dnajc3-006M | Recombinant Mouse Dnajc3 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC3-1822C | Recombinant Chicken DNAJC3 | +Inquiry |
DNAJC3-775H | Recombinant Human DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-124HF | Recombinant Full Length Human DNAJC3 Protein | +Inquiry |
DNAJC3-2760H | Recombinant Human DNAJC3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC3 Products
Required fields are marked with *
My Review for All DNAJC3 Products
Required fields are marked with *