"ERH" Related Products

Expand
Expand

Recombinant Human ERH, His-tagged

Cat.No.: ERH-28693TH
Product Overview: Recombinant full length Human ERH with an N terminal His tag; 127 amino acids with tag, MWt 14.6 kDa.
Description: Enhancer of rudimentary homolog is a protein that in humans is encoded by the ERH gene.
Protein length: 104 amino acids
Conjugation: HIS
Molecular Weight: 14.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in all tissues examined.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Sequence Similarities: Belongs to the E(R) family.
Gene Name: ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ]
Official Symbol: ERH
Synonyms: ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER;
Gene ID: 2079
mRNA Refseq: NM_004450
Protein Refseq: NP_004441
MIM: 601191
Uniprot ID: P84090
Chromosome Location: 14q24.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.