Recombinant Human ERH, His-tagged
Cat.No. : | ERH-28693TH |
Product Overview : | Recombinant full length Human ERH with an N terminal His tag; 127 amino acids with tag, MWt 14.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 104 amino acids |
Description : | Enhancer of rudimentary homolog is a protein that in humans is encoded by the ERH gene. |
Conjugation : | HIS |
Molecular Weight : | 14.600kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues examined. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
Sequence Similarities : | Belongs to the E(R) family. |
Gene Name | ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ERH |
Synonyms | ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; |
Gene ID | 2079 |
mRNA Refseq | NM_004450 |
Protein Refseq | NP_004441 |
MIM | 601191 |
Uniprot ID | P84090 |
Chromosome Location | 14q24.1 |
◆ Recombinant Proteins | ||
ERH-8274Z | Recombinant Zebrafish ERH | +Inquiry |
ERH-1317R | Recombinant Rhesus Macaque ERH Protein, His (Fc)-Avi-tagged | +Inquiry |
ERH-5190H | Recombinant Human ERH protein, GST-tagged | +Inquiry |
ERH-3439H | Recombinant Human ERH protein, His-tagged | +Inquiry |
Erh-974M | Recombinant Mouse Erh Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERH-6555HCL | Recombinant Human ERH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERH Products
Required fields are marked with *
My Review for All ERH Products
Required fields are marked with *