"FADS3" Related Products

Expand

Recombinant Human FADS3

Cat.No.: FADS3-28818TH
Product Overview: Recombinant fragment of Human FADS3 with N terminal proprietary tag. Predicted MW 36.41 kDa.
Description: The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Has been found in heart, liver, lung, uterus, and brainstem.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
Sequence Similarities: Belongs to the fatty acid desaturase family.Contains 1 cytochrome b5 heme-binding domain.
Gene Name: FADS3 fatty acid desaturase 3 [ Homo sapiens ]
Official Symbol: FADS3
Synonyms: FADS3; fatty acid desaturase 3; LLCDL3; CYB5RP; delta 9 desaturase;
Gene ID: 3995
mRNA Refseq: NM_021727
Protein Refseq: NP_068373
MIM: 606150
Uniprot ID: Q9Y5Q0
Chromosome Location: 11q12-q13.1
Pathway: Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem;
Function: heme binding; molecular_function; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.