"GAK" Related Products

Recombinant Human GAK protein, GST-tagged

Cat.No.: GAK-28312TH
Product Overview: Recombinant Human GAK(151 a.a. - 250 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: GAK cyclin G associated kinase [ Homo sapiens ]
Official Symbol: GAK
Synonyms: GAK; cyclin G associated kinase; cyclin-G-associated kinase; auxilin 2; DNAJC26; auxilin-2; DNAJ26; FLJ16629; FLJ40395; MGC99654;
Gene ID: 2580
mRNA Refseq: NM_005255
Protein Refseq: NP_005246
MIM: 602052
UniProt ID: O14976
Chromosome Location: 4p16
Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function: ATP binding; cyclin binding; heat shock protein binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity, transferring phosphorus-containing groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.