"GAK" Related Products

Expand

Recombinant Human GAK protein, GST-tagged

Cat.No.: GAK-28312TH
Product Overview: Recombinant Human GAK(151 a.a. - 250 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: GAK cyclin G associated kinase [ Homo sapiens ]
Official Symbol: GAK
Synonyms: GAK; cyclin G associated kinase; cyclin-G-associated kinase; auxilin 2; DNAJC26; auxilin-2; DNAJ26; FLJ16629; FLJ40395; MGC99654;
Gene ID: 2580
mRNA Refseq: NM_005255
Protein Refseq: NP_005246
MIM: 602052
UniProt ID: O14976
Chromosome Location: 4p16
Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function: ATP binding; cyclin binding; heat shock protein binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; transferase activity, transferring phosphorus-containing groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.