Cat.No.:	GZMK-26150TH
Product Overview:	Recombinant full length Human Granzyme K (amino acids 1-264) with N terminal proprietary tag; predicted MW 55.11 kDa.
Description:	This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.
Protein length:	264 amino acids
Molecular Weight:	55.110kDa inclusive of tags
Source:	Wheat germ
Tissue specificity:	Expressed in lung, spleen, thymus and peripheral blood leukocytes.
Form:	Liquid
Purity:	Proprietary Purification
Storage buffer:	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:	MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPF MASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTV VLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV KLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPD SLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCA GDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP GIYTLLTKKYQTWIKSNLVPPHTN
Sequence Similarities:	Belongs to the peptidase S1 family. Granzyme subfamily.Contains 1 peptidase S1 domain.

Gene Name:	GZMK granzyme K (granzyme 3; tryptase II) [ Homo sapiens ]
Official Symbol:	GZMK
Synonyms:	GZMK; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme K; PRSS; TRYP2;
Gene ID:	3003
mRNA Refseq:	NM_002104
Protein Refseq:	NP_002095
MIM:	600784
Uniprot ID:	P49863
Chromosome Location:	5q11.2
Function:	peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity;

Online Inquiry