Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human GZMK

Cat.No. : GZMK-26150TH
Product Overview : Recombinant full length Human Granzyme K (amino acids 1-264) with N terminal proprietary tag; predicted MW 55.11 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.
Protein length : 264 amino acids
Molecular Weight : 55.110kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in lung, spleen, thymus and peripheral blood leukocytes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPF MASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTV VLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV KLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPD SLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCA GDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP GIYTLLTKKYQTWIKSNLVPPHTN
Sequence Similarities : Belongs to the peptidase S1 family. Granzyme subfamily.Contains 1 peptidase S1 domain.
Gene Name : GZMK granzyme K (granzyme 3; tryptase II) [ Homo sapiens ]
Official Symbol : GZMK
Synonyms : GZMK; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme K; PRSS; TRYP2;
Gene ID : 3003
mRNA Refseq : NM_002104
Protein Refseq : NP_002095
MIM : 600784
Uniprot ID : P49863
Chromosome Location : 5q11.2
Function : peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (3)

Write a review
Reviews
03/01/2022

    Meticulously developed formulations of protein reagents guarantee the accuracy of experimental results.

    06/12/2017

      Protein reagents provide stable quality, yielding consistent experimental results.

      01/23/2016

        The convenient and expedient utilization of protein reagents contributes to enhanced laboratory productivity.

        Ask a Question for All GZMK Products

        Required fields are marked with *

        My Review for All GZMK Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends