Recombinant Human GZMK
Cat.No. : | GZMK-26150TH |
Product Overview : | Recombinant full length Human Granzyme K (amino acids 1-264) with N terminal proprietary tag; predicted MW 55.11 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. |
Protein length : | 264 amino acids |
Molecular Weight : | 55.110kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in lung, spleen, thymus and peripheral blood leukocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPF MASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTV VLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV KLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPD SLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCA GDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP GIYTLLTKKYQTWIKSNLVPPHTN |
Sequence Similarities : | Belongs to the peptidase S1 family. Granzyme subfamily.Contains 1 peptidase S1 domain. |
Gene Name : | GZMK granzyme K (granzyme 3; tryptase II) [ Homo sapiens ] |
Official Symbol : | GZMK |
Synonyms : | GZMK; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme K; PRSS; TRYP2; |
Gene ID : | 3003 |
mRNA Refseq : | NM_002104 |
Protein Refseq : | NP_002095 |
MIM : | 600784 |
Uniprot ID : | P49863 |
Chromosome Location : | 5q11.2 |
Function : | peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; |
Products Types
◆ Recombinant Protein | ||
GZMK-2426R | Recombinant Rat GZMK Protein, His (Fc)-Avi-tagged | +Inquiry |
GZMK-1844R | Recombinant Rhesus Macaque GZMK Protein, His (Fc)-Avi-tagged | +Inquiry |
Gzmk-4525M | Recombinant Mouse Gzmk Protein | +Inquiry |
Gzmk-1609R | Recombinant Rat Gzmk Protein, His-tagged | +Inquiry |
GZMK-4524H | Recombinant Human GZMK Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
GZMK-5667HCL | Recombinant Human GZMK 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionCustomer Reviews (3)
Write a reviewMeticulously developed formulations of protein reagents guarantee the accuracy of experimental results.
Protein reagents provide stable quality, yielding consistent experimental results.
The convenient and expedient utilization of protein reagents contributes to enhanced laboratory productivity.
Ask a Question for All GZMK Products
Required fields are marked with *
My Review for All GZMK Products
Required fields are marked with *
Inquiry Basket