Species : |
Human |
Source : |
Wheat Germ |
Tag : |
Non |
Protein Length : |
110 amino acids |
Description : |
This gene encodes the perlecan protein, which consists of a core protein to which three long chains of glycosaminoglycans (heparan sulfate or chondroitin sulfate) are attached. The perlecan protein is a large multidomain proteoglycan that binds to and cross-links many extracellular matrix components and cell-surface molecules. It has been shown that this protein interacts with laminin, prolargin, collagen type IV, FGFBP1, FBLN2, FGF7 and Transthyretin, etc. and plays essential roles in multiple biological activities. Perlecan is a key component of the vascular extracellular matrix, where it helps to maintain the endothelial barrier function. It is a potent inhibitor of smooth muscle cell proliferation and is thus thought to help maintain vascular homeostasis. It can also promote growth factor (e.g., FGF2) activity and thus stimulate endothelial growth and re-generation. It is a major component of basement membranes, where it is involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. Mutations in this gene cause Schwartz-Jampel syndrome type 1, Silverman-Handmaker type of dyssegmental dysplasia, and Tardive dyskinesia. |
Molecular Weight : |
37.730kDa inclusive of tags |
Tissue specificity : |
Found in the basement membranes. |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSI SGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAG SREFREVSEAVVDTLESEYLKIPGDQVVSV |
Sequence Similarities : |
Contains 4 EGF-like domains.Contains 22 Ig-like C2-type (immunoglobulin-like) domains.Contains 11 laminin EGF-like domains.Contains 3 laminin G-like domains.Contains 3 laminin IV type A domains.Contains 4 LDL-receptor class A domains.Contains 1 SEA domain |