Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human HSPG2

Cat.No. : HSPG2-29309TH
Product Overview : Recombinant fragment of Human Heparan Sulfate Proteoglycan 2 (amino acids 25-134) with N terminal proprietary tag, 37.73kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the perlecan protein, which consists of a core protein to which three long chains of glycosaminoglycans (heparan sulfate or chondroitin sulfate) are attached. The perlecan protein is a large multidomain proteoglycan that binds to and cross-links many extracellular matrix components and cell-surface molecules. It has been shown that this protein interacts with laminin, prolargin, collagen type IV, FGFBP1, FBLN2, FGF7 and Transthyretin, etc. and plays essential roles in multiple biological activities. Perlecan is a key component of the vascular extracellular matrix, where it helps to maintain the endothelial barrier function. It is a potent inhibitor of smooth muscle cell proliferation and is thus thought to help maintain vascular homeostasis. It can also promote growth factor (e.g., FGF2) activity and thus stimulate endothelial growth and re-generation. It is a major component of basement membranes, where it is involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. Mutations in this gene cause Schwartz-Jampel syndrome type 1, Silverman-Handmaker type of dyssegmental dysplasia, and Tardive dyskinesia.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Found in the basement membranes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSI SGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAG SREFREVSEAVVDTLESEYLKIPGDQVVSV
Sequence Similarities : Contains 4 EGF-like domains.Contains 22 Ig-like C2-type (immunoglobulin-like) domains.Contains 11 laminin EGF-like domains.Contains 3 laminin G-like domains.Contains 3 laminin IV type A domains.Contains 4 LDL-receptor class A domains.Contains 1 SEA domain
Gene Name : HSPG2 heparan sulfate proteoglycan 2 [ Homo sapiens ]
Official Symbol : HSPG2
Synonyms : HSPG2; heparan sulfate proteoglycan 2; Schwartz Jampel syndrome 1 (chondrodystrophic myotonia) , SJS1; basement membrane-specific heparan sulfate proteoglycan core protein; perlecan; perlecan proteoglycan; PRCAN;
Gene ID : 3339
mRNA Refseq : NM_005529
Protein Refseq : NP_005520
MIM : 142461
Uniprot ID : P98160
Chromosome Location : 1p36.1-p35
Pathway : Amyloids, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem;
Function : lipoprotein lipase activity; protein C-terminus binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends