"JCHAIN" Related Products

Recombinant Human JCHAIN protein, GST-tagged

Cat.No.: IGJ-29573TH
Product Overview: Recombinant Human JCHAIN(1 a.a. - 159 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: JCHAIN played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 43.23 kDa
AA Sequence: MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDP TSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVET ALTPDACYPD
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: JCHAIN joining chain of multimeric IgA and IgM [ Homo sapiens ]
Official Symbol: JCHAIN
Synonyms: IGJ; immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides; immunoglobulin J chain; IGCJ; IgJ chain; JCH;
Gene ID: 3512
mRNA Refseq: NM_144646
Protein Refseq: NP_653247
MIM: 147790
UniProt ID: P01591
Chromosome Location: 4q21
Function: antigen binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.