Recombinant Human JCHAIN protein, GST-tagged

Cat.No. : IGJ-29573TH
Product Overview : Recombinant Human JCHAIN(1 a.a. - 159 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-159 a.a.
Description : JCHAIN played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.23 kDa
AA Sequence : MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDP TSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVET ALTPDACYPD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name JCHAIN joining chain of multimeric IgA and IgM [ Homo sapiens ]
Official Symbol JCHAIN
Synonyms IGJ; immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides; immunoglobulin J chain; IGCJ; IgJ chain; JCH;
Gene ID 3512
mRNA Refseq NM_144646
Protein Refseq NP_653247
MIM 147790
UniProt ID P01591
Chromosome Location 4q21
Function antigen binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JCHAIN Products

Required fields are marked with *

My Review for All JCHAIN Products

Required fields are marked with *

0
cart-icon