"PEBP1" Related Products

Expand
Expand
Expand

Recombinant Human PEBP1

Cat.No.: PEBP1-30791TH
Product Overview: Recombinant Full Length Human PBP produced in Saccharomyces cerevisiae; 187 amino acids, MWt 21 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: Phosphatidylethanolamine-binding protein 1 is a protein that in humans is encoded by the PEBP1 gene.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV LTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKD PKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTG LHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRK KYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Sequence Similarities: Belongs to the phosphatidylethanolamine-binding protein family.
Gene Name: PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens ]
Official Symbol: PEBP1
Synonyms: PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP;
Gene ID: 5037
mRNA Refseq: NM_002567
Protein Refseq: NP_002558
MIM: 604591
Uniprot ID: P30086
Chromosome Location: 12q24
Pathway: Aurora B signaling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function: ATP binding; lipid binding; mitogen-activated protein kinase binding; nucleotide binding; peptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.