Recombinant Human PEBP1
Cat.No. : | PEBP1-30791TH |
Product Overview : | Recombinant Full Length Human PBP produced in Saccharomyces cerevisiae; 187 amino acids, MWt 21 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
Description : | Phosphatidylethanolamine-binding protein 1 is a protein that in humans is encoded by the PEBP1 gene. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV LTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKD PKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTG LHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRK KYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
Sequence Similarities : | Belongs to the phosphatidylethanolamine-binding protein family. |
Gene Name : | PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens ] |
Official Symbol : | PEBP1 |
Synonyms : | PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP; |
Gene ID : | 5037 |
mRNA Refseq : | NM_002567 |
Protein Refseq : | NP_002558 |
MIM : | 604591 |
Uniprot ID : | P30086 |
Chromosome Location : | 12q24 |
Pathway : | Aurora B signaling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function : | ATP binding; lipid binding; mitogen-activated protein kinase binding; nucleotide binding; peptidase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
PEBP1-3186R | Recombinant Rhesus Macaque PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEBP1-6627M | Recombinant Mouse PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEBP1-4028R | Recombinant Rat PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pebp1-520M | Recombinant Mouse Pebp1 Protein, His-tagged | +Inquiry |
PEBP1-601H | Recombinant Human PEBP1 Protein (Met1-Lys187) | +Inquiry |
◆ Lysates | ||
PEBP1-3311HCL | Recombinant Human PEBP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket