Recombinant Human PEBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PEBP1-2042H |
Product Overview : | PEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002558) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | PEBP1 |
Synonyms | PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP; neuropolypeptide h3; prostatic binding protein; prostatic-binding protein; raf kinase inhibitor protein; PBP; HCNPpp; PEBP-1; |
Gene ID | 5037 |
mRNA Refseq | NM_002567 |
Protein Refseq | NP_002558 |
MIM | 604591 |
UniProt ID | P30086 |
◆ Recombinant Proteins | ||
PEBP1-3186R | Recombinant Rhesus Macaque PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEBP1-4028R | Recombinant Rat PEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEBP1-4874H | Recombinant Human PEBP1 protein, His-tagged | +Inquiry |
PEBP1-30792TH | Recombinant Human PEBP1, His-tagged | +Inquiry |
PEBP1-2042H | Recombinant Human PEBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEBP1-3311HCL | Recombinant Human PEBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEBP1 Products
Required fields are marked with *
My Review for All PEBP1 Products
Required fields are marked with *
0
Inquiry Basket