"PVALB" Related Products

Expand

Recombinant Human PVALB, His-tagged

Cat.No.: PVALB-29530TH
Product Overview: Recombinant full length Human Parvalbumin with an N terminal His tag; 134 amino acids with tag, MWt 14.6kDa.
Description: The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.
Protein length: 110 amino acids
Conjugation: HIS
Molecular Weight: 14.600kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Sequence Similarities: Belongs to the parvalbumin family.Contains 2 EF-hand domains.
Gene Name: PVALB parvalbumin [ Homo sapiens ]
Official Symbol: PVALB
Synonyms: PVALB; parvalbumin; parvalbumin alpha; D22S749;
Gene ID: 5816
mRNA Refseq: NM_002854
Protein Refseq: NP_002845
MIM: 168890
Uniprot ID: P20472
Chromosome Location: 22q13.1
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.