Recombinant Human PVALB, His-tagged
Cat.No. : | PVALB-29530TH |
Product Overview : | Recombinant full length Human Parvalbumin with an N terminal His tag; 134 amino acids with tag, MWt 14.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. |
Conjugation : | HIS |
Molecular Weight : | 14.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES |
Sequence Similarities : | Belongs to the parvalbumin family.Contains 2 EF-hand domains. |
Gene Name | PVALB parvalbumin [ Homo sapiens ] |
Official Symbol | PVALB |
Synonyms | PVALB; parvalbumin; parvalbumin alpha; D22S749; |
Gene ID | 5816 |
mRNA Refseq | NM_002854 |
Protein Refseq | NP_002845 |
MIM | 168890 |
Uniprot ID | P20472 |
Chromosome Location | 22q13.1 |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
PVALB-493H | Recombinant Human PVALB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PVALB-29530TH | Recombinant Human PVALB, His-tagged | +Inquiry |
PVALB-2871H | Recombinant Full Length Human PVALB, His-tagged | +Inquiry |
PVALB-3939C | Recombinant Chicken PVALB | +Inquiry |
PVALB-5262C | Recombinant Cat PVALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVALB-2658HCL | Recombinant Human PVALB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PVALB Products
Required fields are marked with *
My Review for All PVALB Products
Required fields are marked with *