Recombinant Human PVALB, His-tagged

Cat.No. : PVALB-29530TH
Product Overview : Recombinant full length Human Parvalbumin with an N terminal His tag; 134 amino acids with tag, MWt 14.6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 110 amino acids
Description : The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.
Conjugation : HIS
Molecular Weight : 14.600kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Sequence Similarities : Belongs to the parvalbumin family.Contains 2 EF-hand domains.
Gene Name PVALB parvalbumin [ Homo sapiens ]
Official Symbol PVALB
Synonyms PVALB; parvalbumin; parvalbumin alpha; D22S749;
Gene ID 5816
mRNA Refseq NM_002854
Protein Refseq NP_002845
MIM 168890
Uniprot ID P20472
Chromosome Location 22q13.1
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PVALB Products

Required fields are marked with *

My Review for All PVALB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon