"SELL" Related Products

Expand
Expand
Expand

Recombinant Human SELL, Fc-tagged

Cat.No. : SELL-27885TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-343 of Human CD62L fused to the Fc region of human IgG1 , expressed in modified human 293 cells.
Description : This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.
Conjugation : Fc
Tissue specificity : Expressed in B cell lines and T lymphocytes.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence:WTYHYSEKPMNWQRARRFCRDNYTDLVAI QNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNK SLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDD ACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCD VGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSS QCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEP LSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKK KTICESSGIWSNPSPICQKLDKSFSMIKEGDWIPKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK
Sequence Similarities : Belongs to the selectin/LECAM family.Contains 1 C-type lectin domain.Contains 1 EGF-like domain.Contains 2 Sushi (CCP/SCR) domains.
Gene Name : SELL selectin L [ Homo sapiens ]
Official Symbol : SELL
Synonyms : SELL; selectin L; LNHR, LYAM1, lymphocyte adhesion molecule 1; L-selectin; CD62L; hLHRc; LAM 1; LAM1; Leu 8; LSEL; Lyam 1; PLNHR;
Gene ID : 6402
mRNA Refseq : NM_000655
Protein Refseq : NP_000646
MIM : 153240
Uniprot ID : P14151
Chromosome Location : 1q23-q25
Pathway : Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function : carbohydrate binding; cell adhesion molecule binding; glycosphingolipid binding; heparin binding; protease binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.