Recombinant Mouse Sell Protein, His-tagged

Cat.No. : Sell-5756M
Product Overview : Purified recombinant protein of Mouse selectin, lymphocyte (Sell), transcript variant 1 with a C-His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Description : Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
Molecular Mass : 34.1 kDa
AA Sequence : WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNVDHHHHHH
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1×PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Sell selectin, lymphocyte [ Mus musculus (house mouse) ]
Official Symbol Sell
Synonyms SELL; selectin, lymphocyte; L-selectin; LAM-1; LECAM1; lymphocyte antigen 22; lymph node homing receptor; leukocyte adhesion molecule 1; CD62 antigen-like family member L; lymphocyte surface MEL-14 antigen; leukocyte-endothelial cell adhesion molecule 1; Lnhr; CD62L; Ly-22; Lyam1; Ly-m22; Lyam-1; LECAM-1; AI528707
Gene ID 20343
mRNA Refseq NM_011346
Protein Refseq NP_035476
UniProt ID P18337

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sell Products

Required fields are marked with *

My Review for All Sell Products

Required fields are marked with *

0
cart-icon
0
compare icon