"TLR5" Related Products

Expand
Expand
Expand

Recombinant Human TLR5

Cat.No.: TLR5-30142TH
Product Overview: Recombinant fragment of Human TLR5 with a proprietary tag; predicted mwt: 38.61 kDa.
Description: This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.
Protein length: 118 amino acids
Molecular Weight: 38.610kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
Sequence Similarities: Belongs to the Toll-like receptor family.Contains 15 LRR (leucine-rich) repeats.Contains 1 TIR domain.
Gene Name: TLR5 toll-like receptor 5 [ Homo sapiens ]
Official Symbol: TLR5
Synonyms: TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3;
Gene ID: 7100
mRNA Refseq: NM_003268
Protein Refseq: NP_003259
MIM: 603031
Uniprot ID: O60602
Chromosome Location: 1q32.3-q42
Pathway: Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem;
Function: interleukin-1 receptor binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.