Recombinant Human TLR5

• Cat.No.: TLR5-30142TH
• Product Overview: Recombinant fragment of Human TLR5 with a proprietary tag; predicted mwt: 38.61 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 118 amino acids
• Description: This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.
• Molecular Weight: 38.610kDa inclusive of tags
• Tissue specificity: Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
• Sequence Similarities: Belongs to the Toll-like receptor family.Contains 15 LRR (leucine-rich) repeats.Contains 1 TIR domain.

Gene Information

• Gene Name: TLR5 toll-like receptor 5 [ Homo sapiens ]
• Official Symbol: TLR5
• Synonyms: TLR5; toll-like receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3; Toll/interleukin 1 receptor like protein 3
• Gene ID: 7100
• mRNA Refseq: NM_003268
• Protein Refseq: NP_003259
• MIM: 603031
• Uniprot ID: O60602
• Chromosome Location: 1q32.3-q42
• Pathway: Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem
• Function: interleukin-1 receptor binding; receptor activity