Recombinant Active Human CCL26 Protein, Tag Free
Cat.No. : | CCL26-22H |
Product Overview : | Recombinant Active Human CCL26 Protein without Tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. This protein also has antimicrobial activity, displaying an antibacterial effect on S. pneumoniae, S. aureus, Non-typeable H. influenzae, and P. aeruginosa. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq, Jul 2020] |
Form : | Powder |
Bio-activity : | Determined by its ability to chemoattract human CCR3/HEK293 cells. The maximum activity was achieved at 2μg/mL. |
Molecular Mass : | 8.4 kDa |
AA Sequence : | TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Applications : | FuncSt, SDS-PAGE |
Storage : | Lyophilized protein should be stored at -20°C or -80°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Gene Name | CCL26 chemokine (C-C motif) ligand 26 [ Homo sapiens ] |
Official Symbol | CCL26 |
Synonyms | CCL26; chemokine (C-C motif) ligand 26; SCYA26, small inducible cytokine subfamily A (Cys Cys), member 26; C-C motif chemokine 26; CC chemokine IMAC; chemokine N1; eotaxin 3; IMAC; macrophage inflammatory protein 4 alpha; MIP 4a; MIP 4alpha; small inducible cytokine A26; thymic stroma chemokine 1; TSC 1; eotaxin-3; MIP-4-alpha; thymic stroma chemokine-1; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26; TSC-1; MIP-4a; SCYA26; MIP-4alpha; MGC126714; |
Gene ID | 10344 |
mRNA Refseq | NM_006072 |
Protein Refseq | NP_006063 |
MIM | 604697 |
UniProt ID | Q9Y258 |
◆ Recombinant Proteins | ||
CCL26-0876H | Recombinant Human CCL26 Protein (Ser27-Leu94), N-GST tagged | +Inquiry |
CCL26-10847H | Recombinant Human CCL26, GST-tagged | +Inquiry |
CCL26-2946HF | Recombinant Full Length Human CCL26 Protein, GST-tagged | +Inquiry |
CCL26-127C | Active Recombinant Human CCL26 Protein (71 aa) | +Inquiry |
CCL26-025H | Recombinant Human CCL26 protein (Met1-Leu94) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL26-7725HCL | Recombinant Human CCL26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL26 Products
Required fields are marked with *
My Review for All CCL26 Products
Required fields are marked with *