Recombinant Active Human CCL26 Protein, Tag Free

Cat.No. : CCL26-22H
Product Overview : Recombinant Active Human CCL26 Protein without Tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. This protein also has antimicrobial activity, displaying an antibacterial effect on S. pneumoniae, S. aureus, Non-typeable H. influenzae, and P. aeruginosa. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq, Jul 2020]
Form : Powder
Bio-activity : Determined by its ability to chemoattract human CCR3/HEK293 cells. The maximum activity was achieved at 2μg/mL.
Molecular Mass : 8.4 kDa
AA Sequence : TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Applications : FuncSt, SDS-PAGE
Storage : Lyophilized protein should be stored at -20°C or -80°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Gene Name CCL26 chemokine (C-C motif) ligand 26 [ Homo sapiens ]
Official Symbol CCL26
Synonyms CCL26; chemokine (C-C motif) ligand 26; SCYA26, small inducible cytokine subfamily A (Cys Cys), member 26; C-C motif chemokine 26; CC chemokine IMAC; chemokine N1; eotaxin 3; IMAC; macrophage inflammatory protein 4 alpha; MIP 4a; MIP 4alpha; small inducible cytokine A26; thymic stroma chemokine 1; TSC 1; eotaxin-3; MIP-4-alpha; thymic stroma chemokine-1; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26; TSC-1; MIP-4a; SCYA26; MIP-4alpha; MGC126714;
Gene ID 10344
mRNA Refseq NM_006072
Protein Refseq NP_006063
MIM 604697
UniProt ID Q9Y258

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL26 Products

Required fields are marked with *

My Review for All CCL26 Products

Required fields are marked with *

0
cart-icon