Recombinant Active Human LGALS4 Protein, His-tagged(N-ter)

Cat.No. : LGALS4-229H
Product Overview : Recombinant Active Human LGALS4 Protein with His tag (N-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 8 μg/mL.
AA Sequence : AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name LGALS4 lectin, galactoside-binding, soluble, 4 [ Homo sapiens ]
Official Symbol LGALS4
Synonyms LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; GAL4; galectin 4; gal-4; antigen NY-CO-27; lactose-binding lectin 4; L-36 lactose-binding protein; L36LBP;
Gene ID 3960
mRNA Refseq NM_006149
Protein Refseq NP_006140
MIM 602518
UniProt ID P56470

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS4 Products

Required fields are marked with *

My Review for All LGALS4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon