| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-323 aa |
| Description : |
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. |
| Form : |
Liquid |
| Bio-activity : |
The ED50 ≤2 μg/mL. Measured by its ability to ability to agglutinate human red blood cells. |
| Molecular Mass : |
38.1 kDa |
| AASequence : |
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI |
| Endotoxin : |
<1 EU/μg by LAL |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
| Reference : |
1. Huflejt ME., et al. (1997) J Biol Chem. 272(22):14294-303.
2. Huflejt ME., et al. (2004) Glycoconj J. 20(4):247-55. |
| Storage Buffer : |
Liquid in. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT |
