Recombinant Active Human MDK Protein, Tag Free

Cat.No. : MDK-236H
Product Overview : Recombinant Active Human MDK Protein without Tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]
Form : Powder
Bio-activity : Determined by its ability to chemoattract human neutrophils using a concentration range of 0.1-10.0 ng/mL.
Molecular Mass : 13.4 kDa
AA Sequence : VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses
Applications : FuncSt, SDS-PAGE
Storage : Lyophilized protein should be stored at -20°C or -80°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Gene Name MDK midkine (neurite growth-promoting factor 2) [ Homo sapiens ]
Official Symbol MDK
Synonyms MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2;
Gene ID 4192
mRNA Refseq NM_001012333
Protein Refseq NP_001012333
MIM 162096
UniProt ID P21741

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDK Products

Required fields are marked with *

My Review for All MDK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon