Recombinant Active Human MDK Protein, Tag Free
Cat.No. : | MDK-236H |
Product Overview : | Recombinant Active Human MDK Protein without Tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
Form : | Powder |
Bio-activity : | Determined by its ability to chemoattract human neutrophils using a concentration range of 0.1-10.0 ng/mL. |
Molecular Mass : | 13.4 kDa |
AA Sequence : | VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses |
Applications : | FuncSt, SDS-PAGE |
Storage : | Lyophilized protein should be stored at -20°C or -80°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Gene Name | MDK midkine (neurite growth-promoting factor 2) [ Homo sapiens ] |
Official Symbol | MDK |
Synonyms | MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2; |
Gene ID | 4192 |
mRNA Refseq | NM_001012333 |
Protein Refseq | NP_001012333 |
MIM | 162096 |
UniProt ID | P21741 |
◆ Recombinant Proteins | ||
MDK-4496H | Recombinant Human MDK Protein, GST-tagged | +Inquiry |
MDK-441H | Recombinant Human MDK protein, His-tagged | +Inquiry |
MDK-1386H | Recombinant Human MDK Protein, His (Fc)-Avi-tagged | +Inquiry |
MDK-11H | Recombinant Human Midkine Protein, His/S-tagged | +Inquiry |
MDK-216H | Recombinant Human MDK Protein (Val21-Asp143), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDK Products
Required fields are marked with *
My Review for All MDK Products
Required fields are marked with *
0
Inquiry Basket