Recombinant Cynomolgus monkey HAVCR2 Protein, Fc-tagged
Cat.No. : | HAVCR2-734C |
Product Overview : | Recombinant Cynomolgus monkey HAVCR2 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 302 |
Description : | The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance. |
Form : | Lyophilized |
Molecular Mass : | 45.8 kDa |
AA Sequence : | MFSHLPFDCVLLLLLLLLTRSSEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIRTAIYIAAGISAGLALALIFGALIFKWYSHSKEKTQNLSLISLANIPPSGLANAVAEGIRSEENIYTIEEDVYEVEEPNEYYCYVSSGQQPSQPLGCRVAMP |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | HAVCR2 hepatitis A virus cellular receptor 2 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | HAVCR2 |
Synonyms | HAVCR2; hepatitis A virus cellular receptor 2; Tim-3; hepatitis A virus cellular receptor 2; T-cell immunoglobulin mucin receptor 3 |
Gene ID | 714891 |
mRNA Refseq | XM_015141316 |
Protein Refseq | XP_014996802 |
UniProt ID | F7GB92 |
◆ Recombinant Proteins | ||
Havcr2-6823M | Recombinant Mouse Havcr2 Protein (Arg20-Arg191), C-His tagged | +Inquiry |
HAVCR2-319M | Recombinant Mouse HAVCR2 protein(Met1-Arg191), hFc-tagged | +Inquiry |
HAVCR2-319MAF488 | Recombinant Mouse Havcr2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
HAVCR2-3166H | Active Recombinant Human HAVCR2, His tagged | +Inquiry |
Havcr2-113M | Recombinant Mouse HAVCR2 Protein (ECD), His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR2-001CCL | Recombinant Cynomolgus HAVCR2 cell lysate | +Inquiry |
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAVCR2 Products
Required fields are marked with *
My Review for All HAVCR2 Products
Required fields are marked with *
0
Inquiry Basket