Recombinant EBFP Tag Protein, N-6×His tagged

Cat.No. : eBFP-01
Product Overview : Recombinant EBFP Tag protein with N-6×His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Form : Lyophilized
Molecular Mass : 27 kDa
AA Sequence : MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Purity : ≥85% as determined by reducing SDS-PAGE.
Applications : Immunology research
Storage : Reconstituted protein solution can be stored at 4-7 centigrade for 2-3 months, stable at < -20 centigrade for 1-2 years.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution of Urea, Tris-HCl, PH8.0.
Reconstitution : Reconstituted protein solution can be diluted with distilled PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at -20 centigrade temperature.
Synonyms Enhanced blue fluorescence protein; EBFP

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ebfp Products

Required fields are marked with *

My Review for All ebfp Products

Required fields are marked with *

0

Inquiry Basket

cartIcon