Recombinant EBFP Tag Protein, N-6×His tagged

• Cat.No.: eBFP-01
• Product Overview: Recombinant EBFP Tag protein with N-6×His tag was expressed in E. coli.

Specification

• Source: E.coli
• Tag: His
• Form: Lyophilized
• Molecular Mass: 27 kDa
• AA Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Purity: ≥85% as determined by reducing SDS-PAGE.
• Applications: Immunology research
• Storage: Reconstituted protein solution can be stored at 4-7 centigrade for 2-3 months, stable at < -20 centigrade for 1-2 years.
• Storage Buffer: Lyophilized from a 0.2 μm filtered solution of Urea, Tris-HCl, PH8.0.
• Reconstitution: Reconstituted protein solution can be diluted with distilled PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at -20 centigrade temperature.

Gene Information

• Synonyms: Enhanced blue fluorescence protein; EBFP