Recombinant Full Length Human ACMSD Protein, C-Flag-tagged
Cat.No. : | ACMSD-655HFL |
Product Overview : | Recombinant Full Length Human ACMSD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.9 kDa |
AA Sequence : | MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTV QALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPG VQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGG VFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDV IGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Metabolic pathways, Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | ACMSD aminocarboxymuconate semialdehyde decarboxylase [ Homo sapiens (human) ] |
Official Symbol | ACMSD |
Synonyms | 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; aminocarboxymuconate semialdehyde decarboxylase; OTTHUMP00000162500 |
Gene ID | 130013 |
mRNA Refseq | NM_138326.3 |
Protein Refseq | NP_612199.2 |
MIM | 608889 |
UniProt ID | Q8TDX5 |
◆ Recombinant Proteins | ||
ACMSD-5594Z | Recombinant Zebrafish ACMSD | +Inquiry |
ACMSD-256H | Recombinant Human ACMSD Protein, His (Fc)-Avi-tagged | +Inquiry |
ACMSD-451R | Recombinant Rat ACMSD Protein | +Inquiry |
ACMSD-253M | Recombinant Mouse ACMSD Protein, His (Fc)-Avi-tagged | +Inquiry |
ACMSD-910H | Recombinant Human ACMSD Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACMSD-5HCL | Recombinant Human ACMSD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACMSD Products
Required fields are marked with *
My Review for All ACMSD Products
Required fields are marked with *
0
Inquiry Basket