Recombinant Human ACMSD Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ACMSD-1720H |
Product Overview : | ACMSD MS Standard C13 and N15-labeled recombinant protein (NP_612199) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS. |
Molecular Mass : | 38 kDa |
AA Sequence : | MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ACMSD aminocarboxymuconate semialdehyde decarboxylase [ Homo sapiens (human) ] |
Official Symbol | ACMSD |
Synonyms | ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase; |
Gene ID | 130013 |
mRNA Refseq | NM_138326 |
Protein Refseq | NP_612199 |
MIM | 608889 |
UniProt ID | Q8TDX5 |
◆ Recombinant Proteins | ||
ACMSD-256H | Recombinant Human ACMSD Protein, His (Fc)-Avi-tagged | +Inquiry |
Acmsd-41M | Recombinant Mouse Acmsd Protein, His-tagged | +Inquiry |
ACMSD-107R | Recombinant Rat ACMSD Protein, His (Fc)-Avi-tagged | +Inquiry |
ACMSD-10H | Recombinant Human ACMSD Protein, His-tagged | +Inquiry |
ACMSD-655HFL | Recombinant Full Length Human ACMSD Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACMSD-5HCL | Recombinant Human ACMSD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACMSD Products
Required fields are marked with *
My Review for All ACMSD Products
Required fields are marked with *
0
Inquiry Basket