Recombinant Full Length Human ACSL5 Protein, C-Flag-tagged
Cat.No. : | ACSL5-1849HFL |
Product Overview : | Recombinant Full Length Human ACSL5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75.8 kDa |
AA Sequence : | MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPT PALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYT YSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGE KSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYE PTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQN EAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAA MGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGY LKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVH GESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLH PEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | ACSL5 acyl-CoA synthetase long chain family member 5 [ Homo sapiens (human) ] |
Official Symbol | ACSL5 |
Synonyms | ACS2; ACS5; FACL5 |
Gene ID | 51703 |
mRNA Refseq | NM_203379.2 |
Protein Refseq | NP_976313.1 |
MIM | 605677 |
UniProt ID | Q9ULC5 |
◆ Recombinant Proteins | ||
ACSL5-1849HFL | Recombinant Full Length Human ACSL5 Protein, C-Flag-tagged | +Inquiry |
RFL-23345RF | Recombinant Full Length Rat Long-Chain-Fatty-Acid--Coa Ligase 5(Acsl5) Protein, His-Tagged | +Inquiry |
ACSL5-262H | Recombinant Human ACSL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSL5-804HF | Recombinant Full Length Human ACSL5 Protein, GST-tagged | +Inquiry |
ACSL5-2897C | Recombinant Chicken ACSL5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL5-9073HCL | Recombinant Human ACSL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSL5 Products
Required fields are marked with *
My Review for All ACSL5 Products
Required fields are marked with *
0
Inquiry Basket