Recombinant Human ACSL5 Protein, GST-tagged

Cat.No. : ACSL5-201H
Product Overview : Human ACSL5 partial ORF ( NP_057318, 91 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.3 kDa
AA Sequence : PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACSL5 acyl-CoA synthetase long-chain family member 5 [ Homo sapiens ]
Official Symbol ACSL5
Synonyms ACSL5; acyl-CoA synthetase long-chain family member 5; FACL5, fatty acid Coenzyme A ligase, long chain 5; long-chain-fatty-acid--CoA ligase 5; ACS2; ACS5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase; long chain 5; long chain acyl CoA synthetase 5; long chain fatty acid coenzyme A ligase 5; LACS 5; fatty acid coenzyme A ligase 5; long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; fatty-acid-Coenzyme A ligase, long-chain 5; FACL5;
Gene ID 51703
mRNA Refseq NM_016234
Protein Refseq NP_057318
MIM 605677
UniProt ID Q9ULC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACSL5 Products

Required fields are marked with *

My Review for All ACSL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon