Recombinant Full Length Human AMPD1 Protein, C-Flag-tagged
Cat.No. : | AMPD1-331HFL |
Product Overview : | Recombinant Full Length Human AMPD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 90 kDa |
AA Sequence : | MPLFKLPAEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEA RRKKRFQGRKTVNLSIPLSETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGL YRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANESFYPVFTPPVKKGEDPFRTDNLPENLGYHLKM KDGVVYVYPNEAAVSKDEPKPLPYPNLDTFLDDMNFLLALIAQGPVKTYTHRRLKFLSSKFQVHQMLNEM DELKELINNPHRDFYNCRKVDTHIHAAACMNQKHLLRFIKKSYQIDADRVVYSTKEKNLTLKELFAKLKM HPYDLTVDSLDVHAGRQTFQRFDKFNDKYNPVGASELRDLYLKTDNYINGEYFATIIKEVGADLVEAKYQ HAEPRLSIYGRSPDEWSKLSSWFVCNRIHCPNMTWMIQVPRIYDVFRSKNFLPHFGKMLENIFMPVFEAT INPQADPELSVFLKHITGFDSVDDESKHSGHMFSSKSPKPQEWTLEKNPSYTYYAYYMYANIMVLNSLRK ERGMNTFLFRPHCGEAGALTHLMTAFMIADDISHGLNLKKSPVLQYLFFLAQIPIAMSPLSNNSLFLEYA KNPFLDFLQKGLMISLSTDDPMQFHFTKEPLMEEYAIAAQVFKLSTCDMCEVARNSVLQCGISHEEKVKF LGDNYLEEGPAGNDIRRTNVAQIRMAYRYETWCYELNLIAEGLKSTETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Purine metabolism |
Full Length : | Full L. |
Gene Name | AMPD1 adenosine monophosphate deaminase 1 [ Homo sapiens (human) ] |
Official Symbol | AMPD1 |
Synonyms | MAD; MADA; MMDD |
Gene ID | 270 |
mRNA Refseq | NM_000036.3 |
Protein Refseq | NP_000027.3 |
MIM | 102770 |
UniProt ID | P23109 |
◆ Recombinant Proteins | ||
AMPD1-588HF | Recombinant Full Length Human AMPD1 Protein, GST-tagged | +Inquiry |
AMPD1-657R | Recombinant Rat AMPD1 Protein | +Inquiry |
AMPD1-11138Z | Recombinant Zebrafish AMPD1 | +Inquiry |
AMPD1-754H | Recombinant Human AMPD1 protein, GST-tagged | +Inquiry |
AMPD1-313R | Recombinant Rat AMPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMPD1-8877HCL | Recombinant Human AMPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMPD1 Products
Required fields are marked with *
My Review for All AMPD1 Products
Required fields are marked with *
0
Inquiry Basket