Recombinant Full Length Human C4BPA Protein, C-Flag-tagged
Cat.No. : | C4BPA-951HFL |
Product Overview : | Recombinant Full Length Human C4BPA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.6 kDa |
AA Sequence : | MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETR FKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSC SEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLL GHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIH CDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQK NLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELV NGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLP NPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Complement and coagulation cascades |
Full Length : | Full L. |
Gene Name | C4BPA complement component 4 binding protein alpha [ Homo sapiens (human) ] |
Official Symbol | C4BPA |
Synonyms | PRP; C4BP |
Gene ID | 722 |
mRNA Refseq | NM_000715.4 |
Protein Refseq | NP_000706.1 |
MIM | 120830 |
UniProt ID | P04003 |
◆ Recombinant Proteins | ||
C4BPA-6230C | Recombinant Chicken C4BPA | +Inquiry |
C4BPA-951HFL | Recombinant Full Length Human C4BPA Protein, C-Flag-tagged | +Inquiry |
C4BPA-473H | Recombinant Human C4BPA Protein, His (Fc)-Avi-tagged | +Inquiry |
C4BPA-0549H | Recombinant Human C4BPA Protein (Pro289-Leu597), N-His-tagged | +Inquiry |
C4BPA-3578P | Recombinant Pig C4BPA, His-tagged | +Inquiry |
◆ Native Proteins | ||
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4BPA-8037HCL | Recombinant Human C4BPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C4BPA Products
Required fields are marked with *
My Review for All C4BPA Products
Required fields are marked with *
0
Inquiry Basket