Recombinant Human C4BPA protein, GST-tagged
| Cat.No. : | C4BPA-42H |
| Product Overview : | Recombinant Human C4BPA(49 a.a. - 597 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 49-597 a.a. |
| Description : | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 86.13 kDa |
| AA Sequence : | NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | C4BPA complement component 4 binding protein, alpha [ Homo sapiens ] |
| Official Symbol | C4BPA |
| Synonyms | C4BPA; complement component 4 binding protein, alpha; C4BP, complement component 4 binding protein, alpha; C4b-binding protein alpha chain; proline-rich protein; PRP; C4BP; |
| Gene ID | 722 |
| mRNA Refseq | NM_000715 |
| Protein Refseq | NP_000706 |
| MIM | 120830 |
| UniProt ID | P04003 |
| Chromosome Location | 1q32 |
| Pathway | CD40/CD40L signaling, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Pertussis, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| C4BPA-6230C | Recombinant Chicken C4BPA | +Inquiry |
| C4BPA-473H | Recombinant Human C4BPA Protein, His (Fc)-Avi-tagged | +Inquiry |
| C4BPA-4133H | Recombinant Human C4BPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C4BPA-42H | Recombinant Human C4BPA protein, GST-tagged | +Inquiry |
| C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C4BPA-8037HCL | Recombinant Human C4BPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4BPA Products
Required fields are marked with *
My Review for All C4BPA Products
Required fields are marked with *
