Recombinant Human C4BPA protein, GST-tagged

Cat.No. : C4BPA-42H
Product Overview : Recombinant Human C4BPA(49 a.a. - 597 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 49-597 a.a.
Description : This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 86.13 kDa
AA Sequence : NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name C4BPA complement component 4 binding protein, alpha [ Homo sapiens ]
Official Symbol C4BPA
Synonyms C4BPA; complement component 4 binding protein, alpha; C4BP, complement component 4 binding protein, alpha; C4b-binding protein alpha chain; proline-rich protein; PRP; C4BP;
Gene ID 722
mRNA Refseq NM_000715
Protein Refseq NP_000706
MIM 120830
UniProt ID P04003
Chromosome Location 1q32
Pathway CD40/CD40L signaling, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Pertussis, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4BPA Products

Required fields are marked with *

My Review for All C4BPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon