Recombinant Full Length Human CNN2 Protein, C-Flag-tagged
Cat.No. : | CNN2-912HFL |
Product Overview : | Recombinant Full Length Human CNN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA DGAPSGTGDCPDPGEVPEYPPYYQEEAGYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CNN2 calponin 2 [ Homo sapiens (human) ] |
Official Symbol | CNN2 |
Synonyms | calponin 2; calponin H2, smooth muscle; neutral calponin |
Gene ID | 1265 |
mRNA Refseq | NM_004368.4 |
Protein Refseq | NP_004359.1 |
MIM | 602373 |
UniProt ID | Q99439 |
◆ Recombinant Proteins | ||
CNN2-2690H | Recombinant Human CNN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNN2-28010TH | Recombinant Human CNN2 | +Inquiry |
CNN2-4768H | Recombinant Human CNN2 protein, His-SUMO-tagged | +Inquiry |
Cnn2-911M | Recombinant Mouse Cnn2 Protein, MYC/DDK-tagged | +Inquiry |
CNN2-3891C | Recombinant Chicken CNN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNN2 Products
Required fields are marked with *
My Review for All CNN2 Products
Required fields are marked with *
0
Inquiry Basket