Recombinant Human CNN2
| Cat.No. : | CNN2-28010TH |
| Product Overview : | Recombinant fragment of Human CNN2 (amino acids 193-290) with a N terminal proprietary tag; Predicted MWt 36.41 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Tissue specificity : | Heart and smooth muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC |
| Sequence Similarities : | Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain. |
| Gene Name | CNN2 calponin 2 [ Homo sapiens ] |
| Official Symbol | CNN2 |
| Synonyms | CNN2; calponin 2; calponin-2; |
| Gene ID | 1265 |
| mRNA Refseq | NM_004368 |
| Protein Refseq | NP_004359 |
| MIM | 602373 |
| Uniprot ID | Q99439 |
| Chromosome Location | 19p13.3 |
| Pathway | Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; |
| Function | actin binding; calmodulin binding; |
| ◆ Recombinant Proteins | ||
| Cnn2-911M | Recombinant Mouse Cnn2 Protein, MYC/DDK-tagged | +Inquiry |
| CNN2-1929HF | Recombinant Full Length Human CNN2 Protein, GST-tagged | +Inquiry |
| CNN2-11386H | Recombinant Human CNN2, GST-tagged | +Inquiry |
| CNN2-482H | Recombinant Human calponin 2, His-tagged | +Inquiry |
| CNN2-3658M | Recombinant Mouse CNN2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN2 Products
Required fields are marked with *
My Review for All CNN2 Products
Required fields are marked with *
