Recombinant Human CNN2
Cat.No. : | CNN2-28010TH |
Product Overview : | Recombinant fragment of Human CNN2 (amino acids 193-290) with a N terminal proprietary tag; Predicted MWt 36.41 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Heart and smooth muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC |
Sequence Similarities : | Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain. |
Gene Name | CNN2 calponin 2 [ Homo sapiens ] |
Official Symbol | CNN2 |
Synonyms | CNN2; calponin 2; calponin-2; |
Gene ID | 1265 |
mRNA Refseq | NM_004368 |
Protein Refseq | NP_004359 |
MIM | 602373 |
Uniprot ID | Q99439 |
Chromosome Location | 19p13.3 |
Pathway | Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; |
Function | actin binding; calmodulin binding; |
◆ Recombinant Proteins | ||
CNN2-1806M | Recombinant Mouse CNN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN2-3796H | Recombinant Human CNN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNN2-12529Z | Recombinant Zebrafish CNN2 | +Inquiry |
CNN2-5083H | Recombinant Human CNN2, His-tagged | +Inquiry |
CNN2-912HFL | Recombinant Full Length Human CNN2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNN2 Products
Required fields are marked with *
My Review for All CNN2 Products
Required fields are marked with *
0
Inquiry Basket