Recombinant Human CNN2

• Cat.No.: CNN2-28010TH
• Product Overview: Recombinant fragment of Human CNN2 (amino acids 193-290) with a N terminal proprietary tag; Predicted MWt 36.41 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.410kDa inclusive of tags
• Tissue specificity: Heart and smooth muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC
• Sequence Similarities: Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain.

Gene Information

• Gene Name: CNN2 calponin 2 [ Homo sapiens ]
• Official Symbol: CNN2
• Synonyms: CNN2; calponin 2; calponin-2
• Gene ID: 1265
• mRNA Refseq: NM_004368
• Protein Refseq: NP_004359
• MIM: 602373
• Uniprot ID: Q99439
• Chromosome Location: 19p13.3
• Pathway: Myometrial Relaxation and Contraction Pathways, organism-specific biosystem
• Function: actin binding; calmodulin binding