Recombinant Full Length Human CYP2E1 Protein, GST-tagged

Cat.No. : CYP2E1-2388HF
Product Overview : Human CYP2E1 full-length ORF ( NP_000764.1, 1 a.a. - 493 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 493 amino acids
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]
Molecular Mass : 83.2 kDa
AA Sequence : MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYP2E1 cytochrome P450 family 2 subfamily E member 1 [ Homo sapiens (human) ]
Official Symbol CYP2E1
Synonyms CYP2E1; cytochrome P450 family 2 subfamily E member 1; Cytochrome P450 Family 2 Subfamily E Member 1; Cytochrome P450, Subfamily IIE (Ethanol-Inducible), Polypeptide 1; Cytochrome P450, Family 2, Subfamily E, Polypeptide 1; 4-Nitrophenol 2-Hydroxylase; Cytochrome P450-J; CYPIIE1; CYP2E; Flavoprotein-Linked Monooxygenase; Microsomal Monooxygenase; Xenobiotic Monooxygenase; Cytochrome P450 2E1; EC 1.14.13.n7; EC 1.14.14.1; EC 1.14.13.-; P450C2E; P450-J; CPE1; cytochrome P450 2E1; 4-nitrophenol 2-hydroxylase; CYPIIE1; cytochrome P450, family 2, subfamily E, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; cytochrome P450-J; flavoprotein-linked monooxygenase; microsomal monooxygenase; xenobiotic monooxygenase; EC 1.14.13.n7
Gene ID 1571
mRNA Refseq NM_000773
Protein Refseq NP_000764
MIM 124040
UniProt ID P05181

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP2E1 Products

Required fields are marked with *

My Review for All CYP2E1 Products

Required fields are marked with *

0
cart-icon