Recombinant Full Length Human DGAT2 Protein, GST-tagged

Cat.No. : DGAT2-6905HF
Product Overview : Recombinant Human full-length DGAT2(1 a.a. - 388 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 388 amino acids
Description : This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 70.2 kDa
AA Sequence : MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ]
Official Symbol DGAT2
Synonyms DGAT2; diacylglycerol O-acyltransferase 2; diacylglycerol O acyltransferase homolog 2 (mouse); diglyceride acyltransferase 2; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; HMFN1045; GS1999FULL; DKFZp686A15125;
Gene ID 84649
mRNA Refseq NM_001253891
Protein Refseq NP_001240820
MIM 606983
UniProt ID Q96PD7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGAT2 Products

Required fields are marked with *

My Review for All DGAT2 Products

Required fields are marked with *

0
cart-icon